PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013892193.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
Family MYB
Protein Properties Length: 113aa    MW: 13294.6 Da    PI: 10.1604
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013892193.1genomeBUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.95.6e-14953348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      W   Ede+l+ av ++G ++W++I++ +  ++++kqck rw+ +l
   XP_013892193.1  9 IWKNTEDEILKAAVMKYGLNQWARISSLLV-RKSAKQCKARWYEWL 53
                     5999**************************.************986 PP

2Myb_DNA-binding38.82.1e-1260103248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        WT eEde+l+++ k+l++  W+tIa  +g  Rt+ qc +r+ k+l
   XP_013892193.1  60 TEWTREEDEKLLHLAKLLPTQ-WRTIAPIVG--RTPAQCLERYEKLL 103
                      68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.426253IPR017930Myb domain
SMARTSM007177.6E-14655IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-19961IPR009057Homeodomain-like
CDDcd001675.01E-111053No hitNo description
PfamPF139214.4E-141070No hitNo description
SuperFamilySSF466893.24E-2233109IPR009057Homeodomain-like
PROSITE profilePS5129420.51754107IPR017930Myb domain
CDDcd116591.08E-3055107No hitNo description
SMARTSM007171.2E-1258105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-1462104IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009870Biological Processdefense response signaling pathway, resistance gene-dependent
GO:0010204Biological Processdefense response signaling pathway, resistance gene-independent
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 113 aa     Download sequence    Send to blast
MRIQIKGGIW KNTEDEILKA AVMKYGLNQW ARISSLLVRK SAKQCKARWY EWLDPAIKKT  60
EWTREEDEKL LHLAKLLPTQ WRTIAPIVGR TPAQCLERYE KLLDMAVGKD DRN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W5e-5731112110Pre-mRNA-splicing factor cdc5
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00028SELEXTransfer from AT1G09770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4589622e-54AF458962.1 Zea mays CDC5 protein (CDC5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013892193.14e-78pre-mRNA-splicing factor CDC5/CEF1
SwissprotP929483e-68CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLA0A0D2KB484e-78A0A0D2KB48_9CHLO; Pre-mRNA-splicing factor CDC5/CEF1
STRINGEDP033223e-66(Chlamydomonas reinhardtii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP10401617
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.12e-69cell division cycle 5
Publications ? help Back to Top
  1. Bogen C, et al.
    Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production.
    BMC Genomics, 2013. 14: p. 926
    [PMID:24373495]